CDS

Accession Number TCMCG036C13605
gbkey CDS
Protein Id PTQ37278.1
Location join(582207..582220,582554..582579,582799..582911,583115..583198,583357..583477,583625..583764)
GeneID Phytozome:Mapoly0058s0064
Organism Marchantia polymorpha
locus_tag MARPO_0058s0064

Protein

Length 165aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA53523, BioSample:SAMN00769973
db_source KZ772730.1
Definition hypothetical protein MARPO_0058s0064 [Marchantia polymorpha]
Locus_tag MARPO_0058s0064

EGGNOG-MAPPER Annotation

COG_category L
Description Bifunctional DNA N-glycosylase with associated apurinic apyrimidinic (AP) lyase function that catalyzes the first step in base excision repair (BER), the primary repair pathway for the repair of oxidative DNA damage. The DNA N-glycosylase activity releases the damaged DNA base from DNA by cleaving the N- glycosidic bond, leaving an AP site. The AP lyase activity cleaves the phosphodiester bond 3' to the AP site by a beta-elimination. Primarily recognizes and repairs oxidative base damage of pyrimidines
KEGG_TC -
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko01000        [VIEW IN KEGG]
ko03400        [VIEW IN KEGG]
KEGG_ko ko:K10773        [VIEW IN KEGG]
EC 4.2.99.18        [VIEW IN KEGG]        [VIEW IN INGREDIENT]
KEGG_Pathway ko03410        [VIEW IN KEGG]
map03410        [VIEW IN KEGG]
GOs GO:0000702        [VIEW IN EMBL-EBI]
GO:0000703        [VIEW IN EMBL-EBI]
GO:0003674        [VIEW IN EMBL-EBI]
GO:0003824        [VIEW IN EMBL-EBI]
GO:0003906        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005634        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005783        [VIEW IN EMBL-EBI]
GO:0005911        [VIEW IN EMBL-EBI]
GO:0006139        [VIEW IN EMBL-EBI]
GO:0006259        [VIEW IN EMBL-EBI]
GO:0006281        [VIEW IN EMBL-EBI]
GO:0006284        [VIEW IN EMBL-EBI]
GO:0006285        [VIEW IN EMBL-EBI]
GO:0006289        [VIEW IN EMBL-EBI]
GO:0006296        [VIEW IN EMBL-EBI]
GO:0006464        [VIEW IN EMBL-EBI]
GO:0006479        [VIEW IN EMBL-EBI]
GO:0006725        [VIEW IN EMBL-EBI]
GO:0006807        [VIEW IN EMBL-EBI]
GO:0006950        [VIEW IN EMBL-EBI]
GO:0006974        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0008152        [VIEW IN EMBL-EBI]
GO:0008168        [VIEW IN EMBL-EBI]
GO:0008170        [VIEW IN EMBL-EBI]
GO:0008213        [VIEW IN EMBL-EBI]
GO:0008276        [VIEW IN EMBL-EBI]
GO:0008757        [VIEW IN EMBL-EBI]
GO:0009295        [VIEW IN EMBL-EBI]
GO:0009506        [VIEW IN EMBL-EBI]
GO:0009507        [VIEW IN EMBL-EBI]
GO:0009532        [VIEW IN EMBL-EBI]
GO:0009536        [VIEW IN EMBL-EBI]
GO:0009570        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0012505        [VIEW IN EMBL-EBI]
GO:0016278        [VIEW IN EMBL-EBI]
GO:0016279        [VIEW IN EMBL-EBI]
GO:0016740        [VIEW IN EMBL-EBI]
GO:0016741        [VIEW IN EMBL-EBI]
GO:0016787        [VIEW IN EMBL-EBI]
GO:0016798        [VIEW IN EMBL-EBI]
GO:0016799        [VIEW IN EMBL-EBI]
GO:0018022        [VIEW IN EMBL-EBI]
GO:0018193        [VIEW IN EMBL-EBI]
GO:0018205        [VIEW IN EMBL-EBI]
GO:0019104        [VIEW IN EMBL-EBI]
GO:0019538        [VIEW IN EMBL-EBI]
GO:0030054        [VIEW IN EMBL-EBI]
GO:0032259        [VIEW IN EMBL-EBI]
GO:0033554        [VIEW IN EMBL-EBI]
GO:0033683        [VIEW IN EMBL-EBI]
GO:0034641        [VIEW IN EMBL-EBI]
GO:0036211        [VIEW IN EMBL-EBI]
GO:0042644        [VIEW IN EMBL-EBI]
GO:0042646        [VIEW IN EMBL-EBI]
GO:0043170        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043228        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043232        [VIEW IN EMBL-EBI]
GO:0043412        [VIEW IN EMBL-EBI]
GO:0043414        [VIEW IN EMBL-EBI]
GO:0044237        [VIEW IN EMBL-EBI]
GO:0044238        [VIEW IN EMBL-EBI]
GO:0044260        [VIEW IN EMBL-EBI]
GO:0044267        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044434        [VIEW IN EMBL-EBI]
GO:0044435        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0046483        [VIEW IN EMBL-EBI]
GO:0050896        [VIEW IN EMBL-EBI]
GO:0051716        [VIEW IN EMBL-EBI]
GO:0055044        [VIEW IN EMBL-EBI]
GO:0071704        [VIEW IN EMBL-EBI]
GO:0090304        [VIEW IN EMBL-EBI]
GO:0090305        [VIEW IN EMBL-EBI]
GO:0140096        [VIEW IN EMBL-EBI]
GO:0140097        [VIEW IN EMBL-EBI]
GO:1901360        [VIEW IN EMBL-EBI]
GO:1901564        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGAAGATCCAAAGGTATTGGTACCTAAATGGCCCATCTGATTATGAATGTTGGGCGGATGTCCAGGGCATCTGTGTTGACACTCATGTTCATCGCATATGCAACCGACTGGAGTGGGTTAAACACGCCAAATCTACTCCAAGCCATCGACTGAACACAAATACTTCTGAAGAAACCAGAGCTTCATTAGAACAATGGCTTCCCAAAGATGAATGGAACTCGATCAATCCTCTACTGGTGGGCTTTGGCCAAACTGTATGTACCCCTCTAAGACCTCACTGTACGGACTGTCTCATCAACCAGCTTTGCCCCGCTGCTGTTATGGAGCCTATAAAGAGCCCAAGTAGAAGCCTTGCACAATCGCCATTTCCCTTGAGTCTCCCGCATGCTTTCAGATACTACATCTTCGTGAAGGGCGCTCAAACGAGTTTCGAGTTCGGAAGCAACGACGTCGAGGCCCCTTGGCCCGTAAATTTTGACACAAGGTTAGAATTCTAG
Protein:  
MKIQRYWYLNGPSDYECWADVQGICVDTHVHRICNRLEWVKHAKSTPSHRLNTNTSEETRASLEQWLPKDEWNSINPLLVGFGQTVCTPLRPHCTDCLINQLCPAAVMEPIKSPSRSLAQSPFPLSLPHAFRYYIFVKGAQTSFEFGSNDVEAPWPVNFDTRLEF